SCOPe 2.07: Domain d1szna1: 1szn A:315-417

Lineage for d1szna1 (1szn A:315-417)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Trichoderma reesei [TaxId:51453] [110300] (2 PDB entries)
   Uniprot Q92456; Alpha-galactosidase agl1;

8. Domain d1szna1: 1szn A:315-417 [106162]
   Other proteins in same PDB: d1szna2
   complexed with bma, gol, man, nag

Details for d1szna1

PDB Entry: 1szn, 1.54 Å

PDB Description: the structure of alpha-galactosidase

PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1szna1:

Sequence; same for both SEQRES and ATOM records:

>d1szna1 b.71.1.1 (A:315-417) Melibiase {Trichoderma reesei [TaxId: 51453]}
vygqpatpykwginpdwtfnvtypaefwagpsskghlvlmvntlditatkeakwneipgl
saghyevrdvwsdkdlgclssykaavaahdtavilvgkkcqrw

Timeline for d1szna1:

• d1szna1 first appeared in SCOP 1.69
  
• d1szna1 appears in SCOPe 2.06
  
• d1szna1 appears in the current release, SCOPe 2.08