Lineage for d1szna2 (1szn A:1-314)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438921Protein Melibiase [75064] (4 species)
  7. 2438970Species Trichoderma reesei [TaxId:51453] [110349] (2 PDB entries)
    Alpha-galactosidase agl1
    Uniprot Q92456
  8. 2438972Domain d1szna2: 1szn A:1-314 [106163]
    Other proteins in same PDB: d1szna1
    complexed with bma, gol, man, nag

Details for d1szna2

PDB Entry: 1szn (more details), 1.54 Å

PDB Description: the structure of alpha-galactosidase
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1szna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szna2 c.1.8.1 (A:1-314) Melibiase {Trichoderma reesei [TaxId: 51453]}
ivmpdgvtgkvpslgwnswnayhcdideskflsaaelivssglldagynyvniddcwsmk
dgrvdghiapnatrfpdgidglakkvhalglklgiystagtatcagypaslgyedvdaad
fadwgvdylkydncnvpsdwqdeyvacnpdfvktgpngtcttaldptlappgydwstsks
aerfgamrnalakqsheivlsmciwgqadvfswgnstgiswrmsddispnwgsvtrilnl
nsfklnsvdfwghndadmlevgngnltaaetrthfalwaamksplligtdlaqlsqnnin
llknkhllafnqds

SCOPe Domain Coordinates for d1szna2:

Click to download the PDB-style file with coordinates for d1szna2.
(The format of our PDB-style files is described here.)

Timeline for d1szna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szna1