Lineage for d1szna1 (1szn A:315-417)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077200Protein Melibiase [75020] (4 species)
  7. 2077241Species Trichoderma reesei [TaxId:51453] [110300] (2 PDB entries)
    Uniprot Q92456; Alpha-galactosidase agl1;
  8. 2077242Domain d1szna1: 1szn A:315-417 [106162]
    Other proteins in same PDB: d1szna2
    complexed with gol

Details for d1szna1

PDB Entry: 1szn (more details), 1.54 Å

PDB Description: the structure of alpha-galactosidase
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1szna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szna1 b.71.1.1 (A:315-417) Melibiase {Trichoderma reesei [TaxId: 51453]}
vygqpatpykwginpdwtfnvtypaefwagpsskghlvlmvntlditatkeakwneipgl
saghyevrdvwsdkdlgclssykaavaahdtavilvgkkcqrw

SCOPe Domain Coordinates for d1szna1:

Click to download the PDB-style file with coordinates for d1szna1.
(The format of our PDB-style files is described here.)

Timeline for d1szna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szna2