Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) |
Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins) found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain SMART 00582; Pfam PF04818 |
Protein PCF11 protein [109976] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109977] (2 PDB entries) Uniprot P39081 1-140 |
Domain d1sz9a1: 1sz9 A:2-140 [106139] Other proteins in same PDB: d1sz9a2, d1sz9b2, d1sz9c2 |
PDB Entry: 1sz9 (more details), 2.1 Å
SCOPe Domain Sequences for d1sz9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sz9a1 a.118.9.4 (A:2-140) PCF11 protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp lfegsalekieqflikasa
Timeline for d1sz9a1:
View in 3D Domains from other chains: (mouse over for more information) d1sz9b1, d1sz9b2, d1sz9c1, d1sz9c2 |