SCOPe 2.07: Domain d1sz1b2: 1sz1 B:1-142

Lineage for d1sz1b2 (1sz1 B:1-142)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
   similar overall structure to poly(A) polymerase, PAP

6. Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [102942] (26 PDB entries)
   Uniprot O28126

8. Domain d1sz1b2: 1sz1 B:1-142 [106137]
   Other proteins in same PDB: d1sz1a1, d1sz1a3, d1sz1b1, d1sz1b3
   protein/RNA complex

Details for d1sz1b2

PDB Entry: 1sz1, 6.21 Å

PDB Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes

PDB Compounds: (B:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1sz1b2:

Sequence; same for both SEQRES and ATOM records:

>d1sz1b2 d.218.1.7 (B:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

Timeline for d1sz1b2:

• d1sz1b2 first appeared in SCOP 1.69
  
• d1sz1b2 appears in SCOPe 2.06
  
• d1sz1b2 appears in the current release, SCOPe 2.08