![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein) similar overall structure to poly(A) polymerase, PAP |
![]() | Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [102942] (26 PDB entries) Uniprot O28126 |
![]() | Domain d1sz1b2: 1sz1 B:1-142 [106137] Other proteins in same PDB: d1sz1a1, d1sz1a3, d1sz1b1, d1sz1b3 protein/RNA complex |
PDB Entry: 1sz1 (more details), 6.21 Å
SCOPe Domain Sequences for d1sz1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sz1b2 d.218.1.7 (B:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep kniksavdrtpfhhkwlegrik
Timeline for d1sz1b2: