| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.1: Pointed domain [47770] (6 proteins) |
| Protein GABP-alpha subunit [109867] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [109868] (1 PDB entry) Uniprot Q00422 168-254 # structure of the Ets domain (320-429) is also known (46868) |
| Domain d1sxda_: 1sxd A: [106079] |
PDB Entry: 1sxd (more details)
SCOPe Domain Sequences for d1sxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxda_ a.60.1.1 (A:) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]}
gshmaalegyrkeqerlgipydpihwstdqvlhwvvwvmkefsmtdidlttlnisgrelc
slnqedffqrvprgeilwshlellrkyvlas
Timeline for d1sxda_: