Lineage for d1sxda1 (1sxd A:168-254)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1998616Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1998617Family a.60.1.1: Pointed domain [47770] (7 protein domains)
  6. 1998648Protein GABP-alpha subunit [109867] (1 species)
  7. 1998649Species Mouse (Mus musculus) [TaxId:10090] [109868] (1 PDB entry)
    Uniprot Q00422 168-254 # structure of the Ets domain (320-429) is also known (46868)
  8. 1998650Domain d1sxda1: 1sxd A:168-254 [106079]
    Other proteins in same PDB: d1sxda2

Details for d1sxda1

PDB Entry: 1sxd (more details)

PDB Description: Solution Structure of the Pointed (PNT) Domain from mGABPa
PDB Compounds: (A:) GA repeat binding protein, alpha

SCOPe Domain Sequences for d1sxda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxda1 a.60.1.1 (A:168-254) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]}
aalegyrkeqerlgipydpihwstdqvlhwvvwvmkefsmtdidlttlnisgrelcslnq
edffqrvprgeilwshlellrkyvlas

SCOPe Domain Coordinates for d1sxda1:

Click to download the PDB-style file with coordinates for d1sxda1.
(The format of our PDB-style files is described here.)

Timeline for d1sxda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sxda2