SCOPe 2.08: Domain d1sxda1: 1sxd A:168-254

Lineage for d1sxda1 (1sxd A:168-254)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein GABP-alpha subunit [109867] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109868] (1 PDB entry)
   Uniprot Q00422 168-254 # structure of the Ets domain (320-429) is also known (46868)

8. Domain d1sxda1: 1sxd A:168-254 [106079]
   Other proteins in same PDB: d1sxda2

Details for d1sxda1

PDB Entry: 1sxd

PDB Description: solution structure of the pointed (pnt) domain from mgabpa

PDB Compounds: (A:) GA repeat binding protein, alpha

SCOPe Domain Sequences for d1sxda1:

Sequence; same for both SEQRES and ATOM records:

>d1sxda1 a.60.1.1 (A:168-254) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]}
aalegyrkeqerlgipydpihwstdqvlhwvvwvmkefsmtdidlttlnisgrelcslnq
edffqrvprgeilwshlellrkyvlas

Timeline for d1sxda1:

• d1sxda1 first appeared in SCOP 1.69, called d1sxda_
  
• d1sxda1 appears in SCOPe 2.07