![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.186: KaiA/RbsU domain [101214] (1 superfamily) 4 helices; bundle, right-handed twist; right-handed superhelix |
![]() | Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) ![]() |
![]() | Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein) |
![]() | Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species) |
![]() | Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries) Uniprot Q79V62 174-283 |
![]() | Domain d1suyb1: 1suy B:204-307 [106034] Other proteins in same PDB: d1suya2, d1suyb2 complexed with the KaiC C-terminal peptide (Uniprot Q79V60 488-518), chains C and D |
PDB Entry: 1suy (more details)
SCOPe Domain Sequences for d1suyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suyb1 a.186.1.1 (B:204-307) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]} rmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleihvel mdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev
Timeline for d1suyb1: