PDB entry 1suy

View 1suy on RCSB PDB site
Description: NMR structure of the ThKaiA180C-CIIABD complex (average minimized structure)
Class: circadian clock protein
Keywords: X-class Four Helix Bundle, Protein-peptide complex, CIRCADIAN CLOCK PROTEIN
Deposited on 2004-03-26, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: circadian clock protein KaiA
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: KaiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79V62
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1suya1, d1suya2
  • Chain 'B':
    Compound: circadian clock protein KaiA
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: KaiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79V62 (3-106)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1suyb1, d1suyb2
  • Chain 'C':
    Compound: circadian clock protein KaiC
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RR33
      • cloning artifact (0-2)
  • Chain 'D':
    Compound: circadian clock protein KaiC
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RR33 (3-33)
      • cloning artifact (0-2)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suyA (A:)
    amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
    velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1suyB (B:)
    amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
    velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.