Lineage for d1suyb_ (1suy B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450326Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 450327Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 450328Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. 450329Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)
  7. 450335Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
  8. 450340Domain d1suyb_: 1suy B: [106034]
    complexed with the KaiC C-terminal peptide (SQ Q79V60 488-518), chains C and D

Details for d1suyb_

PDB Entry: 1suy (more details)

PDB Description: NMR structure of the ThKaiA180C-CIIABD complex (average minimized structure)

SCOP Domain Sequences for d1suyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suyb_ a.186.1.1 (B:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1}
amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

SCOP Domain Coordinates for d1suyb_:

Click to download the PDB-style file with coordinates for d1suyb_.
(The format of our PDB-style files is described here.)

Timeline for d1suyb_: