SCOPe 2.01: Domain d1sumb_: 1sum B:

Lineage for d1sumb_ (1sum B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (1 family)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.1: PhoU-like [109756] (3 proteins)
   Pfam PF01895
   this is a repeat family; one repeat unit is 1vct A:9-107 found in domain

6. Protein PhoU homolog TM1734 [109757] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [109758] (1 PDB entry)
   Uniprot Q9X256

8. Domain d1sumb_: 1sum B: [106025]
   Structural genomics target
   complexed with ca, fe, ni, po3

Details for d1sumb_

PDB Entry: 1sum, 2 Å

PDB Description: crystal structure of a hypothetical protein at 2.0 a resolution

PDB Compounds: (B:) Phosphate transport system protein phoU homolog 2

SCOPe Domain Sequences for d1sumb_:

Sequence; same for both SEQRES and ATOM records:

>d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]}
nrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiqe
kamevlglfspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledipa
manqtsemlkfalrmfadvnveksfevcrmdskvddlyekvreelllymmespkyvkral
llleiagnieiiadyatnivevsvymvqgeaykcyhdelllfkks

Timeline for d1sumb_:

• d1sumb_ first appeared in SCOP 1.69
  
• d1sumb_ appears in SCOP 1.75
  
• d1sumb_ appears in SCOPe 2.02
  
• d1sumb_ appears in the current release, SCOPe 2.08