Class a: All alpha proteins [46456] (218 folds) |
Fold a.7: Spectrin repeat-like [46965] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.12: PhoU-like (Pfam 01895) [109755] (1 family) duplication: consists of two sequence each repeats adopting this fold |
Family a.7.12.1: PhoU-like (Pfam 01895) [109756] (1 protein) this is a repeat family; one repeat unit is 1vct A:9-107 found in domain |
Protein PhoU homolog TM1734 [109757] (1 species) |
Species Thermotoga maritima [TaxId:243274] [109758] (1 PDB entry) |
Domain d1sumb_: 1sum B: [106025] Structural genomics target |
PDB Entry: 1sum (more details), 2 Å
SCOP Domain Sequences for d1sumb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima} nrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiqe kamevlglfspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledipa manqtsemlkfalrmfadvnveksfevcrmdskvddlyekvreelllymmespkyvkral llleiagnieiiadyatnivevsvymvqgeaykcyhdelllfkks
Timeline for d1sumb_: