Lineage for d1sumb_ (1sum B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439641Fold a.7: Spectrin repeat-like [46965] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 439803Superfamily a.7.12: PhoU-like (Pfam 01895) [109755] (1 family) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 439804Family a.7.12.1: PhoU-like (Pfam 01895) [109756] (1 protein)
    this is a repeat family; one repeat unit is 1vct A:9-107 found in domain
  6. 439805Protein PhoU homolog TM1734 [109757] (1 species)
  7. 439806Species Thermotoga maritima [TaxId:243274] [109758] (1 PDB entry)
  8. 439807Domain d1sumb_: 1sum B: [106025]
    Structural genomics target

Details for d1sumb_

PDB Entry: 1sum (more details), 2 Å

PDB Description: crystal structure of a hypothetical protein at 2.0 a resolution

SCOP Domain Sequences for d1sumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima}
nrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiqe
kamevlglfspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledipa
manqtsemlkfalrmfadvnveksfevcrmdskvddlyekvreelllymmespkyvkral
llleiagnieiiadyatnivevsvymvqgeaykcyhdelllfkks

SCOP Domain Coordinates for d1sumb_:

Click to download the PDB-style file with coordinates for d1sumb_.
(The format of our PDB-style files is described here.)

Timeline for d1sumb_: