Lineage for d1sumb_ (1sum B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985195Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985527Superfamily a.7.12: PhoU-like [109755] (2 families) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 1985528Family a.7.12.1: PhoU-like [109756] (3 protein domains)
    Pfam PF01895
  6. 1985547Protein PhoU homolog TM1734 [109757] (1 species)
  7. 1985548Species Thermotoga maritima [TaxId:2336] [109758] (1 PDB entry)
    Uniprot Q9X256
  8. 1985549Domain d1sumb_: 1sum B: [106025]
    Structural genomics target
    complexed with ca, fe, ni, po3

Details for d1sumb_

PDB Entry: 1sum (more details), 2 Å

PDB Description: Crystal structure of a hypothetical protein at 2.0 A resolution
PDB Compounds: (B:) Phosphate transport system protein phoU homolog 2

SCOPe Domain Sequences for d1sumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sumb_ a.7.12.1 (B:) PhoU homolog TM1734 {Thermotoga maritima [TaxId: 2336]}
nrllnekveefkkgvlkagwfiekmfrnsisslverneslareviadeevvdqmeveiqe
kamevlglfspigkplltvtagirvaelieniadkchdiaknvlelmeepplkpledipa
manqtsemlkfalrmfadvnveksfevcrmdskvddlyekvreelllymmespkyvkral
llleiagnieiiadyatnivevsvymvqgeaykcyhdelllfkks

SCOPe Domain Coordinates for d1sumb_:

Click to download the PDB-style file with coordinates for d1sumb_.
(The format of our PDB-style files is described here.)

Timeline for d1sumb_: