Lineage for d1sqma1 (1sqm A:461-610)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006601Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
  6. 2006602Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 2006603Species Human (Homo sapiens) [TaxId:9606] [63610] (49 PDB entries)
    Uniprot P09960
  8. 2006640Domain d1sqma1: 1sqm A:461-610 [105941]
    Other proteins in same PDB: d1sqma2, d1sqma3
    complexed with acy, imd, yb, zn

Details for d1sqma1

PDB Entry: 1sqm (more details), 2.3 Å

PDB Description: structure of [r563a] leukotriene a4 hydrolase
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d1sqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqma1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgamkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d1sqma1:

Click to download the PDB-style file with coordinates for d1sqma1.
(The format of our PDB-style files is described here.)

Timeline for d1sqma1: