Lineage for d1sqma3 (1sqm A:209-460)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530011Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2530027Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 2530028Species Human (Homo sapiens) [TaxId:9606] [64340] (57 PDB entries)
    Uniprot P09960
  8. 2530082Domain d1sqma3: 1sqm A:209-460 [105943]
    Other proteins in same PDB: d1sqma1, d1sqma2
    complexed with acy, imd, yb, zn

Details for d1sqma3

PDB Entry: 1sqm (more details), 2.3 Å

PDB Description: structure of [r563a] leukotriene a4 hydrolase
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d1sqma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqma3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d1sqma3:

Click to download the PDB-style file with coordinates for d1sqma3.
(The format of our PDB-style files is described here.)

Timeline for d1sqma3: