Lineage for d1sqma3 (1sqm A:209-460)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 507856Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 508245Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein)
    adopts thermolysin-like fold
  6. 508246Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 508247Species Human (Homo sapiens) [TaxId:9606] [64340] (4 PDB entries)
  8. 508251Domain d1sqma3: 1sqm A:209-460 [105943]
    Other proteins in same PDB: d1sqma1, d1sqma2

Details for d1sqma3

PDB Entry: 1sqm (more details), 2.3 Å

PDB Description: structure of [r563a] leukotriene a4 hydrolase

SCOP Domain Sequences for d1sqma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqma3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens)}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOP Domain Coordinates for d1sqma3:

Click to download the PDB-style file with coordinates for d1sqma3.
(The format of our PDB-style files is described here.)

Timeline for d1sqma3: