Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.47: VP4 membrane interaction domain [111378] (1 superfamily) 2 domains; d1: complexed all-beta fold; d2: coiled-coil (trimeric) helical region |
Superfamily f.47.1: VP4 membrane interaction domain [111379] (1 family) automatically mapped to Pfam PF00426 |
Family f.47.1.1: VP4 membrane interaction domain [111380] (1 protein) |
Protein VP4 membrane interaction domain [111381] (1 species) |
Species Rhesus rotavirus [TaxId:10969] [111382] (1 PDB entry) Uniprot Q91HI9 253-522 |
Domain d1slqe_: 1slq E: [105723] |
PDB Entry: 1slq (more details), 3.2 Å
SCOPe Domain Sequences for d1slqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1slqe_ f.47.1.1 (E:) VP4 membrane interaction domain {Rhesus rotavirus [TaxId: 10969]} sktslwkemqynrditirfkfassivksgglgykwseisfkpanyqytytrdgeevtaht tcsvngmndfnfnggslptdfvisryevikensyvyvdywddsqafrnmvyvrslaanln svictggdysfalpvgqwpvmtggavslhsagvtlstqftdfvslnslrfrfrltveeps fsitrtrvsrlyglpaanpnngkeyyevagrfslislvpsnddyqtpitnsvtvrqdler qlgelreefnalsqeiamsqlidlall
Timeline for d1slqe_: