Lineage for d1slqc_ (1slq C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028620Fold f.47: VP4 membrane interaction domain [111378] (1 superfamily)
    2 domains; d1: complexed all-beta fold; d2: coiled-coil (trimeric) helical region
  4. 3028621Superfamily f.47.1: VP4 membrane interaction domain [111379] (1 family) (S)
    automatically mapped to Pfam PF00426
  5. 3028622Family f.47.1.1: VP4 membrane interaction domain [111380] (1 protein)
  6. 3028623Protein VP4 membrane interaction domain [111381] (1 species)
  7. 3028624Species Rhesus rotavirus [TaxId:10969] [111382] (1 PDB entry)
    Uniprot Q91HI9 253-522
  8. 3028627Domain d1slqc_: 1slq C: [105721]

Details for d1slqc_

PDB Entry: 1slq (more details), 3.2 Å

PDB Description: Crystal structure of the trimeric state of the rhesus rotavirus VP4 membrane interaction domain, VP5CT
PDB Compounds: (C:) vp4

SCOPe Domain Sequences for d1slqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slqc_ f.47.1.1 (C:) VP4 membrane interaction domain {Rhesus rotavirus [TaxId: 10969]}
edivvsktslwkemqynrditirfkfassivksgglgykwseisfkpanyqytytrdgee
vtahttcsvngmndfnfnggslptdfvisryevikensyvyvdywddsqafrnmvyvrsl
aanlnsvictggdysfalpvgqwpvmtggavslhsagvtlstqftdfvslnslrfrfrlt
veepsfsitrtrvsrlyglpaanpnngkeyyevagrfslislvpsnddyqtpitnsvtvr
qdlerqlgelreefnalsqeiamsql

SCOPe Domain Coordinates for d1slqc_:

Click to download the PDB-style file with coordinates for d1slqc_.
(The format of our PDB-style files is described here.)

Timeline for d1slqc_: