| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries) Uniprot P01903 28-207 |
| Domain d1sjha2: 1sjh A:4-81 [105649] Other proteins in same PDB: d1sjha1, d1sjhb1, d1sjhb2, d1sjhd1, d1sjhd2 |
PDB Entry: 1sjh (more details), 2.25 Å
SCOPe Domain Sequences for d1sjha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjha2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp
Timeline for d1sjha2:
View in 3DDomains from other chains: (mouse over for more information) d1sjhb1, d1sjhb2, d1sjhd1, d1sjhd2 |