Lineage for d1sjha2 (1sjh A:4-81)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. Domain d1sjha2: 1sjh A:4-81 [105649]
    Other proteins in same PDB: d1sjha1, d1sjhb1, d1sjhb2, d1sjhd1, d1sjhd2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1sjha2

PDB Entry: 1sjh (more details), 2.25 Å

PDB Description: hla-dr1 complexed with a 13 residue hiv capsid peptide
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1sjha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjha2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1sjha2 are not available.

Timeline for d1sjha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sjha1
View in 3D
Domains from other chains:
(mouse over for more information)
d1sjhb1, d1sjhb2, d1sjhd1, d1sjhd2