![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries) |
![]() | Domain d1sjha2: 1sjh A:4-81 [105649] Other proteins in same PDB: d1sjha1, d1sjhb1, d1sjhb2, d1sjhd1, d1sjhd2 |
PDB Entry: 1sjh (more details), 2.25 Å
SCOP Domain Sequences for d1sjha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjha2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1sjha2:
![]() Domains from other chains: (mouse over for more information) d1sjhb1, d1sjhb2, d1sjhd1, d1sjhd2 |