![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein N-acylamino acid racemase [110372] (4 species) |
![]() | Species Amycolatopsis sp. [TaxId:37632] [110373] (4 PDB entries) Uniprot Q44244 # similar activity to a remotely related O-succinylbenzoate synthase from E. coli |
![]() | Domain d1sjbd1: 1sjb D:126-368 [105622] Other proteins in same PDB: d1sjba2, d1sjbb2, d1sjbc2, d1sjbd2 complexed with mg, osb |
PDB Entry: 1sjb (more details), 2.2 Å
SCOPe Domain Sequences for d1sjbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjbd1 c.1.11.2 (D:126-368) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcggmietglgraanval aslpnftlpgdtsasdrfyktditepfvlsgghlpvptgpglgvapipelldevttakvw igs
Timeline for d1sjbd1: