SCOPe 2.08: Domain d1sjbd2: 1sjb D:1-125

Lineage for d1sjbd2 (1sjb D:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Amycolatopsis sp. [TaxId:37632] [110938] (4 PDB entries)
   Uniprot Q44244; similar activity to a remotely related O-succinylbenzoate synthase from E. coli

8. Domain d1sjbd2: 1sjb D:1-125 [105623]
   Other proteins in same PDB: d1sjba1, d1sjbb1, d1sjbc1, d1sjbd1
   complexed with mg, osb

Details for d1sjbd2

PDB Entry: 1sjb, 2.2 Å

PDB Description: X-ray structure of o-succinylbenzoate synthase complexed with o-succinylbenzoic acid

PDB Compounds: (D:) N-acylamino acid racemase

SCOPe Domain Sequences for d1sjbd2:

Sequence; same for both SEQRES and ATOM records:

>d1sjbd2 d.54.1.1 (D:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d1sjbd2:

• d1sjbd2 first appeared in SCOP 1.69
  
• d1sjbd2 appears in SCOPe 2.07