SCOPe 2.08: Domain d1s9ha1: 1s9h A:225-490

Lineage for d1s9ha1 (1s9h A:225-490)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Rep 40 protein helicase domain [110564] (1 species)

7. Species Adeno-associated virus 2, AAV2 [TaxId:10804] [110565] (2 PDB entries)
   Uniprot P03132 225-490

8. Domain d1s9ha1: 1s9h A:225-490 [105381]
   Other proteins in same PDB: d1s9ha2, d1s9hb2, d1s9hc2
   has additional subdomain(s) that are not in the common domain

Details for d1s9ha1

PDB Entry: 1s9h, 2.4 Å

PDB Description: Crystal Structure of Adeno-associated virus Type 2 Rep40

PDB Compounds: (A:) Rep 40 protein

SCOPe Domain Sequences for d1s9ha1:

Sequence; same for both SEQRES and ATOM records:

>d1s9ha1 c.37.1.20 (A:225-490) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}
melvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdyl
vgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktnia
eaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvdqk
ckssaqidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvtkq
evkdffrwakdhvvevehefyvkkgg

Timeline for d1s9ha1:

• d1s9ha1 first appeared in SCOP 1.69, called d1s9ha_
  
• d1s9ha1 appears in SCOPe 2.07