Lineage for d1s9ha_ (1s9h A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485481Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 485644Protein Rep 40 protein helicase domain [110564] (1 species)
  7. 485645Species Adeno-associated virus 2, AAV2 [TaxId:10804] [110565] (2 PDB entries)
  8. 485647Domain d1s9ha_: 1s9h A: [105381]

Details for d1s9ha_

PDB Entry: 1s9h (more details), 2.4 Å

PDB Description: Crystal Structure of Adeno-associated virus Type 2 Rep40

SCOP Domain Sequences for d1s9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9ha_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2}
agmelvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapd
ylvgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktn
iaeaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvd
qkckssaqidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvt
kqevkdffrwakdhvvevehefyvkkgg

SCOP Domain Coordinates for d1s9ha_:

Click to download the PDB-style file with coordinates for d1s9ha_.
(The format of our PDB-style files is described here.)

Timeline for d1s9ha_: