SCOP 1.69: Domain d1s9ha_: 1s9h A:

Lineage for d1s9ha_ (1s9h A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Rep 40 protein helicase domain [110564] (1 species)

7. Species Adeno-associated virus 2, AAV2 [TaxId:10804] [110565] (2 PDB entries)

8. Domain d1s9ha_: 1s9h A: [105381]

Details for d1s9ha_

PDB Entry: 1s9h, 2.4 Å

PDB Description: Crystal Structure of Adeno-associated virus Type 2 Rep40

SCOP Domain Sequences for d1s9ha_:

Sequence; same for both SEQRES and ATOM records:

>d1s9ha_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2}
agmelvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapd
ylvgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktn
iaeaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvd
qkckssaqidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvt
kqevkdffrwakdhvvevehefyvkkgg

Timeline for d1s9ha_:

• d1s9ha_ is new in SCOP 1.69
  
• d1s9ha_ appears in SCOP 1.71
  
• d1s9ha_ appears in the current release, SCOPe 2.08, called d1s9ha1