![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
![]() | Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries) Uniprot P20276 includes the N-terminal tail |
![]() | Domain d1s72a2: 1s72 A:1-90 [105319] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with cd, cl, k, mg, na missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1s72 (more details), 2.4 Å
SCOPe Domain Sequences for d1s72a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]} grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef edgdrrlilapegvgvgdelqvgvsaeiap
Timeline for d1s72a2:
![]() Domains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |