SCOPe 2.08: Domain d1s72k_: 1s72 K:

Lineage for d1s72k_ (1s72 K:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)
   automatically mapped to Pfam PF00238

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
   Uniprot P22450

8. Domain d1s72k_: 1s72 K: [105330]
   Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
   complexed with cd, cl, k, mg, na

Details for d1s72k_

PDB Entry: 1s72, 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution

PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1s72k_:

Sequence; same for both SEQRES and ATOM records:

>d1s72k_ b.39.1.1 (K:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1s72k_:

• d1s72k_ first appeared in SCOP 1.69
  
• d1s72k_ appears in SCOPe 2.07