Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.10: Glycogen synthesis protein GlgS [109747] (1 family) automatically mapped to Pfam PF08971 |
Family a.7.10.1: Glycogen synthesis protein GlgS [109748] (1 protein) this is a repeat family; one repeat unit is 1rrz A: found in domain |
Protein Glycogen synthesis protein GlgS [109749] (1 species) |
Species Escherichia coli [TaxId:562] [109750] (1 PDB entry) Uniprot P26649 |
Domain d1rrza_: 1rrz A: [105086] Structural genomics target |
PDB Entry: 1rrz (more details)
SCOPe Domain Sequences for d1rrza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrza_ a.7.10.1 (A:) Glycogen synthesis protein GlgS {Escherichia coli [TaxId: 562]} mdhslnslnnfdflarsfarmhaegrpvdilavtgnmdeehrtwfcaryawycqqmmqar eleleh
Timeline for d1rrza_: