Lineage for d1rrza_ (1rrz A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439641Fold a.7: Spectrin repeat-like [46965] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 439791Superfamily a.7.10: Glycogen synthesis protein GlgS [109747] (1 family) (S)
  5. 439792Family a.7.10.1: Glycogen synthesis protein GlgS [109748] (1 protein)
    this is a repeat family; one repeat unit is 1rrz A: found in domain
  6. 439793Protein Glycogen synthesis protein GlgS [109749] (1 species)
  7. 439794Species Escherichia coli [TaxId:562] [109750] (1 PDB entry)
  8. 439795Domain d1rrza_: 1rrz A: [105086]
    Structural genomics target

Details for d1rrza_

PDB Entry: 1rrz (more details)

PDB Description: solution structure of glgs protein from e. coli

SCOP Domain Sequences for d1rrza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrza_ a.7.10.1 (A:) Glycogen synthesis protein GlgS {Escherichia coli}
mdhslnslnnfdflarsfarmhaegrpvdilavtgnmdeehrtwfcaryawycqqmmqar
eleleh

SCOP Domain Coordinates for d1rrza_:

Click to download the PDB-style file with coordinates for d1rrza_.
(The format of our PDB-style files is described here.)

Timeline for d1rrza_: