SCOPe 2.08: Domain d1rrza_: 1rrz A:

Lineage for d1rrza_ (1rrz A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.10: Glycogen synthesis protein GlgS [109747] (1 family)
   automatically mapped to Pfam PF08971

5. Family a.7.10.1: Glycogen synthesis protein GlgS [109748] (1 protein)
   this is a repeat family; one repeat unit is 1rrz A: found in domain

6. Protein Glycogen synthesis protein GlgS [109749] (1 species)

7. Species Escherichia coli [TaxId:562] [109750] (1 PDB entry)
   Uniprot P26649

8. Domain d1rrza_: 1rrz A: [105086]
   Structural genomics target

Details for d1rrza_

PDB Entry: 1rrz

PDB Description: solution structure of glgs protein from e. coli

PDB Compounds: (A:) Glycogen synthesis protein glgS

SCOPe Domain Sequences for d1rrza_:

Sequence; same for both SEQRES and ATOM records:

>d1rrza_ a.7.10.1 (A:) Glycogen synthesis protein GlgS {Escherichia coli [TaxId: 562]}
mdhslnslnnfdflarsfarmhaegrpvdilavtgnmdeehrtwfcaryawycqqmmqar
eleleh

Timeline for d1rrza_:

• d1rrza_ first appeared in SCOP 1.69
  
• d1rrza_ appears in SCOPe 2.07