Lineage for d1rrza_ (1rrz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985195Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985510Superfamily a.7.10: Glycogen synthesis protein GlgS [109747] (1 family) (S)
    automatically mapped to Pfam PF08971
  5. 1985511Family a.7.10.1: Glycogen synthesis protein GlgS [109748] (1 protein)
  6. 1985512Protein Glycogen synthesis protein GlgS [109749] (1 species)
  7. 1985513Species Escherichia coli [TaxId:562] [109750] (1 PDB entry)
    Uniprot P26649
  8. 1985514Domain d1rrza_: 1rrz A: [105086]
    Structural genomics target

Details for d1rrza_

PDB Entry: 1rrz (more details)

PDB Description: Solution structure of GlgS protein from E. coli
PDB Compounds: (A:) Glycogen synthesis protein glgS

SCOPe Domain Sequences for d1rrza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrza_ a.7.10.1 (A:) Glycogen synthesis protein GlgS {Escherichia coli [TaxId: 562]}
mdhslnslnnfdflarsfarmhaegrpvdilavtgnmdeehrtwfcaryawycqqmmqar
eleleh

SCOPe Domain Coordinates for d1rrza_:

Click to download the PDB-style file with coordinates for d1rrza_.
(The format of our PDB-style files is described here.)

Timeline for d1rrza_: