Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.14: Middle operon regulator, Mor [109659] (1 protein) contains extra N-terminal dimerisation subdomain: alpha-hairpin (27-72) dimer is a four-helical bundle with right-handed twist automatically mapped to Pfam PF08765 |
Protein Middle operon regulator, Mor [109660] (1 species) |
Species Bacteriophage Mu [TaxId:10677] [109661] (1 PDB entry) Uniprot P23848 27-120 |
Domain d1rr7a_: 1rr7 A: [105075] complexed with pt |
PDB Entry: 1rr7 (more details), 2.2 Å
SCOPe Domain Sequences for d1rr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]} rfpallaelndllrgelsrlgvdpahsleivvaickhlgggqvyiprgqaldslirdlri wndfngrnvselttrygvtfntvykairrmrrlk
Timeline for d1rr7a_: