Lineage for d1rr7a_ (1rr7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692629Family a.4.1.14: Middle operon regulator, Mor [109659] (1 protein)
    contains extra N-terminal dimerisation subdomain: alpha-hairpin (27-72) dimer is a four-helical bundle with right-handed twist
    automatically mapped to Pfam PF08765
  6. 2692630Protein Middle operon regulator, Mor [109660] (1 species)
  7. 2692631Species Bacteriophage Mu [TaxId:10677] [109661] (1 PDB entry)
    Uniprot P23848 27-120
  8. 2692632Domain d1rr7a_: 1rr7 A: [105075]
    complexed with pt

Details for d1rr7a_

PDB Entry: 1rr7 (more details), 2.2 Å

PDB Description: Crystal structure of the Middle Operon Regulator protein of Bacteriophage Mu
PDB Compounds: (A:) Middle operon regulator

SCOPe Domain Sequences for d1rr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rr7a_ a.4.1.14 (A:) Middle operon regulator, Mor {Bacteriophage Mu [TaxId: 10677]}
rfpallaelndllrgelsrlgvdpahsleivvaickhlgggqvyiprgqaldslirdlri
wndfngrnvselttrygvtfntvykairrmrrlk

SCOPe Domain Coordinates for d1rr7a_:

Click to download the PDB-style file with coordinates for d1rr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1rr7a_: