Lineage for d1rqga3 (1rqg A:139-173)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036287Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family) (S)
  5. 3036288Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein)
    in the Pyrococcus abyssi MetRS structure there is a tandem repeat of two such domains swapped with their zinc-binding 'knuckles', this duplicated finger occupies a larger region (124-183) than defined below; there is a structurally equivalent region in the E. coli enzyme lacking the second zinc-binding site
  6. 3036289Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (2 species)
  7. 3036300Species Pyrococcus abyssi [TaxId:29292] [111451] (1 PDB entry)
    Uniprot Q9V011 1-606; C-domain 616-722 is solved separately: 1MKH
  8. 3036301Domain d1rqga3: 1rqg A:139-173 [105065]
    Other proteins in same PDB: d1rqga1, d1rqga2
    complexed with zn

Details for d1rqga3

PDB Entry: 1rqg (more details), 2.9 Å

PDB Description: Methionyl-tRNA synthetase from Pyrococcus abyssi
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1rqga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]}
vigtcpycgaedqkgdqcevcgrpltpeilinprc

SCOPe Domain Coordinates for d1rqga3:

Click to download the PDB-style file with coordinates for d1rqga3.
(The format of our PDB-style files is described here.)

Timeline for d1rqga3: