Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family) |
Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein) in the Pyrococcus abyssi MetRS structure there is a tandem repeat of two such domains swapped with their zinc-binding 'knuckles', this duplicated finger occupies a larger region (124-183) than defined below; there is a structurally equivalent region in the E. coli enzyme lacking the second zinc-binding site |
Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (2 species) |
Species Pyrococcus abyssi [TaxId:29292] [111451] (1 PDB entry) Uniprot Q9V011 1-606; C-domain 616-722 is solved separately: 1MKH |
Domain d1rqga3: 1rqg A:139-173 [105065] Other proteins in same PDB: d1rqga1, d1rqga2 complexed with zn |
PDB Entry: 1rqg (more details), 2.9 Å
SCOPe Domain Sequences for d1rqga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} vigtcpycgaedqkgdqcevcgrpltpeilinprc
Timeline for d1rqga3: