Lineage for d1rqdb_ (1rqd B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. Family c.31.1.1: Deoxyhypusine synthase, DHS [52468] (2 proteins)
    automatically mapped to Pfam PF01916
  6. Protein Deoxyhypusine synthase, DHS [52469] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52470] (14 PDB entries)
    Uniprot P49366
  8. Domain d1rqdb_: 1rqd B: [105060]
    complexed with gc7, nad

Details for d1rqdb_

PDB Entry: 1rqd (more details), 3 Å

PDB Description: deoxyhypusine synthase holoenzyme in its low ionic strength, high pH crystal form with the inhibitor GC7 bound in the active site
PDB Compounds: (B:) deoxyhypusine synthase

SCOPe Domain Sequences for d1rqdb_:

Sequence, based on SEQRES records: (download)

>d1rqdb_ c.31.1.1 (B:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]}
stqvrgydfnrgvnyralleafgttgfqatnfgravqqvnamiekkleplsqdedqhadl
tqsrrpltsctiflgytsnlissgiretirylvqhnmvdvlvttaggveedlikclapty
lgefslrgkelrenginrignllvpnenyckfedwlmpildqmvmeqntegvkwtpskmi
arlgkeinnpesvyywaqknhipvfspaltdgslgdmiffhsyknpglvldivedlrlin
tqaifakctgmiilgggvvkhhiananlmrngadyavyintaqefdgsdsgarpdeavsw
gkirvdaqpvkvyadaslvfpllvaetfaqkmdafm

Sequence, based on observed residues (ATOM records): (download)

>d1rqdb_ c.31.1.1 (B:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]}
stqvrgydfnrgvnyralleafgttgfqatnfgravqqvnamiekkleplpltsctiflg
ytsnlissgiretirylvqhnmvdvlvttaggveedlikclaptylgefslrgkelreng
inrignllvpnenyckfedwlmpildqmvmeqntegvkwtpskmiarlgkeinnpesvyy
waqknhipvfspaltdgslgdmiffhsyknpglvldivedlrlintqaifakctgmiilg
ggvvkhhiananlmrngadyavyintaqefdgsdsgarpdeavswgkirvdaqpvkvyad
aslvfpllvaetfaqkmdafm

SCOPe Domain Coordinates for d1rqdb_ are not available.

Timeline for d1rqdb_:

Domains from other chains:
(mouse over for more information)
d1rqda_