Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (38 proteins) |
Protein IgE high affinity receptor alpha subunit [49200] (1 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries) Uniprot P12319 29-196 |
Domain d1rpqd2: 1rpq D:86-171 [105035] complexed with cit, man, nag, so4 |
PDB Entry: 1rpq (more details), 3 Å
SCOP Domain Sequences for d1rpqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rpqd2 b.1.1.4 (D:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved sgtyyctgkvwqldyeseplnitvik
Timeline for d1rpqd2: