Lineage for d1rpqd2 (1rpq D:86-171)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753734Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753735Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
    Uniprot P12319 29-196
  8. 2753745Domain d1rpqd2: 1rpq D:86-171 [105035]
    complexed with cit, nag, so4

Details for d1rpqd2

PDB Entry: 1rpq (more details), 3 Å

PDB Description: high affinity ige receptor (alpha chain) complexed with tight-binding e131 'zeta' peptide from phage display
PDB Compounds: (D:) High affinity immunoglobulin epsilon receptor alpha-subunit precursor

SCOPe Domain Sequences for d1rpqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpqd2 b.1.1.4 (D:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvik

SCOPe Domain Coordinates for d1rpqd2:

Click to download the PDB-style file with coordinates for d1rpqd2.
(The format of our PDB-style files is described here.)

Timeline for d1rpqd2: