Lineage for d1rpqa1 (1rpq A:4-85)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787213Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 787214Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
    Uniprot P12319 29-196
  8. 787217Domain d1rpqa1: 1rpq A:4-85 [105028]

Details for d1rpqa1

PDB Entry: 1rpq (more details), 3 Å

PDB Description: high affinity ige receptor (alpha chain) complexed with tight-binding e131 'zeta' peptide from phage display
PDB Compounds: (A:) High affinity immunoglobulin epsilon receptor alpha-subunit precursor

SCOP Domain Sequences for d1rpqa1:

Sequence, based on SEQRES records: (download)

>d1rpqa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
kpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records): (download)

>d1rpqa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
kpkvslnppwnrifkgenvtltcngnnvsstkwfhngslseetnsslnivnakfedsgey
kcqhqqvnesepvylevfs

SCOP Domain Coordinates for d1rpqa1:

Click to download the PDB-style file with coordinates for d1rpqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rpqa1: