Lineage for d1rpqa1 (1rpq A:4-85)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026186Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2026352Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2026353Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
    Uniprot P12319 29-196
  8. 2026370Domain d1rpqa1: 1rpq A:4-85 [105028]
    complexed with cit, ndg, so4

Details for d1rpqa1

PDB Entry: 1rpq (more details), 3 Å

PDB Description: High Affinity IgE Receptor (alpha chain) Complexed with Tight-Binding E131 'zeta' Peptide from Phage Display
PDB Compounds: (A:) High affinity immunoglobulin epsilon receptor alpha-subunit precursor

SCOPe Domain Sequences for d1rpqa1:

Sequence, based on SEQRES records: (download)

>d1rpqa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
kpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records): (download)

>d1rpqa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
kpkvslnppwnrifkgenvtltcngnnvsstkwfhngslseetnsslnivnakfedsgey
kcqhqqvnesepvylevfs

SCOPe Domain Coordinates for d1rpqa1:

Click to download the PDB-style file with coordinates for d1rpqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rpqa1: