Lineage for d1rj2g1 (1rj2 G:624-818)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919183Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 919184Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 919185Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 919189Protein Dbl's big sister, Dbs [74743] (1 species)
  7. 919190Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
    Uniprot Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence
  8. 919201Domain d1rj2g1: 1rj2 G:624-818 [104958]
    Other proteins in same PDB: d1rj2a2, d1rj2d2, d1rj2g2, d1rj2j2

Details for d1rj2g1

PDB Entry: 1rj2 (more details), 3 Å

PDB Description: Crystal structure of the DH/PH fragment of Dbs without bound GTPase
PDB Compounds: (G:) Guanine nucleotide exchange factor DBS [Fragment]

SCOPe Domain Sequences for d1rj2g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj2g1 a.87.1.1 (G:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

SCOPe Domain Coordinates for d1rj2g1:

Click to download the PDB-style file with coordinates for d1rj2g1.
(The format of our PDB-style files is described here.)

Timeline for d1rj2g1: