Lineage for d1rj2d2 (1rj2 D:819-950)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957216Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 957257Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 957258Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
    SQ Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence
  8. 957268Domain d1rj2d2: 1rj2 D:819-950 [104957]
    Other proteins in same PDB: d1rj2a1, d1rj2d1, d1rj2g1, d1rj2j1

Details for d1rj2d2

PDB Entry: 1rj2 (more details), 3 Å

PDB Description: Crystal structure of the DH/PH fragment of Dbs without bound GTPase
PDB Compounds: (D:) Guanine nucleotide exchange factor DBS [Fragment]

SCOPe Domain Sequences for d1rj2d2:

Sequence, based on SEQRES records: (download)

>d1rj2d2 b.55.1.1 (D:819-950) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlq

Sequence, based on observed residues (ATOM records): (download)

>d1rj2d2 b.55.1.1 (D:819-950) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkelarfkpmqrhlflhekavlfckkreekapsys
ykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirkvltsqlq

SCOPe Domain Coordinates for d1rj2d2:

Click to download the PDB-style file with coordinates for d1rj2d2.
(The format of our PDB-style files is described here.)

Timeline for d1rj2d2: