Class g: Small proteins [56992] (75 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins) |
Protein Complement control protein [57539] (1 species) |
Species Vaccinia virus [TaxId:10245] [57540] (7 PDB entries) a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans |
Domain d1rida2: 1rid A:65-126 [104944] |
PDB Entry: 1rid (more details), 2.1 Å
SCOP Domain Sequences for d1rida2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rida2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus} rrcpsprdidngqldiggvdfgssityscnsgyhligesksycelgstgsmvwnpeapic es
Timeline for d1rida2:
View in 3D Domains from other chains: (mouse over for more information) d1ridb1, d1ridb2, d1ridb3, d1ridb4 |