SCOP 1.69: Domain d1rida3: 1rid A:127-184

Lineage for d1rida3 (1rid A:127-184)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins)

6. Protein Complement control protein [57539] (1 species)

7. Species Vaccinia virus [TaxId:10245] [57540] (7 PDB entries)
   a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

8. Domain d1rida3: 1rid A:127-184 [104945]

Details for d1rida3

PDB Entry: 1rid, 2.1 Å

PDB Description: vaccinia complement protein in complex with heparin

SCOP Domain Sequences for d1rida3:

Sequence; same for both SEQRES and ATOM records:

>d1rida3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus}
vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqi

Timeline for d1rida3:

• d1rida3 is new in SCOP 1.69
  
• d1rida3 appears in SCOP 1.71
  
• d1rida3 appears in the current release, SCOPe 2.08