PDB entry 1rid

View 1rid on RCSB PDB site
Description: vaccinia complement protein in complex with heparin
Deposited on 2003-11-17, released 2004-06-22
Made obsolete on 2018-05-09

The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ridA (A:)
    cctipsrpinmkfknsvetdananynigdtieylclpgyrkqkmgpiyakctgtgwtlfn
    qcikrrcpsprdidngqldiggvdfgssityscnsgyhligesksycelgstgsmvwnpe
    apicesvkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpp
    tcqivkcphptisngylssgfkrsysyndnvdfkckygyklsgsssstcspgntwkpelp
    kcvr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ridB (B:)
    cctipsrpinmkfknsvetdananynigdtieylclpgyrkqkmgpiyakctgtgwtlfn
    qcikrrcpsprdidngqldiggvdfgssityscnsgyhligesksycelgstgsmvwnpe
    apicesvkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpp
    tcqivkcphptisngylssgfkrsysyndnvdfkckygyklsgsssstcspgntwkpelp
    kcvr