![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Synaptic protein PSD-95 [50162] (2 species) Synonym: synapse associated protein 90, sap90 duplication: contains three PDZ domains |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (14 PDB entries) Uniprot P31016 62-154 |
![]() | Domain d1rgra_: 1rgr A: [104931] complexed with bal |
PDB Entry: 1rgr (more details)
SCOPe Domain Sequences for d1rgra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]} eyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfvn evdvrevthsaavealkeagsivrlyvmrrkpp
Timeline for d1rgra_: