PDB entry 1rgr

View 1rgr on RCSB PDB site
Description: Cyclic Peptides Targeting PDZ Domains of PSD-95: Structural Basis for Enhanced Affinity and Enzymatic Stability
Class: structural protein/de novo protein
Keywords: PDZ1 domain, STRUCTURAL PROTEIN-DE NOVO PROTEIN COMPLEX
Deposited on 2003-11-12, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Presynaptic density protein 95
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rgra_
  • Chain 'B':
    Compound: postsynaptic protein CRIPT peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAC40102 (0-5)
      • engineered (2)
      • engineered (4)
  • Heterogens: BAL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rgrA (A:)
    eyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfvn
    evdvrevthsaavealkeagsivrlyvmrrkpphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgrA (A:)
    eyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfvn
    evdvrevthsaavealkeagsivrlyvmrrkpp
    

  • Chain 'B':
    No sequence available.