Lineage for d1rgra_ (1rgr A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462260Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 462261Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 462262Family b.36.1.1: PDZ domain [50157] (29 proteins)
    Pfam 00595
  6. 462375Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 462378Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (6 PDB entries)
  8. 462384Domain d1rgra_: 1rgr A: [104931]

Details for d1rgra_

PDB Entry: 1rgr (more details)

PDB Description: cyclic peptides targeting pdz domains of psd-95: structural basis for enhanced affinity and enzymatic stability

SCOP Domain Sequences for d1rgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus)}
eyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfvn
evdvrevthsaavealkeagsivrlyvmrrkpp

SCOP Domain Coordinates for d1rgra_:

Click to download the PDB-style file with coordinates for d1rgra_.
(The format of our PDB-style files is described here.)

Timeline for d1rgra_: