SCOPe 2.01: Domain d1rgig1: 1rgi G:26-152

Lineage for d1rgig1 (1rgi G:26-152)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries)
   Uniprot Q28372 1-346

8. Domain d1rgig1: 1rgi G:26-152 [104928]
   Other proteins in same PDB: d1rgia1, d1rgia2
   complexed with atp, ca

Details for d1rgig1

PDB Entry: 1rgi, 3 Å

PDB Description: crystal structure of gelsolin domains g1-g3 bound to actin

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1rgig1:

Sequence; same for both SEQRES and ATOM records:

>d1rgig1 d.109.1.1 (G:26-152) Gelsolin {Horse (Equus caballus) [TaxId: 9796]}
vvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngilqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asgfkhv

Timeline for d1rgig1:

• d1rgig1 first appeared in SCOP 1.69
  
• d1rgig1 appears in SCOP 1.75
  
• d1rgig1 appears in SCOPe 2.02
  
• d1rgig1 appears in the current release, SCOPe 2.08