Lineage for d1rgig3 (1rgi G:263-371)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037751Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037752Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1037753Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 1037754Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1037755Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries)
    Uniprot Q28372 1-346
  8. 1037770Domain d1rgig3: 1rgi G:263-371 [104930]
    Other proteins in same PDB: d1rgia1, d1rgia2
    complexed with atp, ca

Details for d1rgig3

PDB Entry: 1rgi (more details), 3 Å

PDB Description: crystal structure of gelsolin domains g1-g3 bound to actin
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1rgig3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgig3 d.109.1.1 (G:263-371) Gelsolin {Horse (Equus caballus) [TaxId: 9796]}
edaanrklaklykvsngagpmvvslvadenpfaqgalrsedcfildhgkdgkifvwkgkq
anmeerkaalktasdfiskmdypkqtqvsvlpeggetplfrqffknwrd

SCOPe Domain Coordinates for d1rgig3:

Click to download the PDB-style file with coordinates for d1rgig3.
(The format of our PDB-style files is described here.)

Timeline for d1rgig3: