![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
![]() | Protein Gelsolin [55759] (2 species) consists of six similar domains |
![]() | Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries) Uniprot Q28372 1-346 |
![]() | Domain d1rgig1: 1rgi G:26-152 [104928] Other proteins in same PDB: d1rgia1, d1rgia2 complexed with atp, ca |
PDB Entry: 1rgi (more details), 3 Å
SCOPe Domain Sequences for d1rgig1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgig1 d.109.1.1 (G:26-152) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} vvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngilqydl hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv asgfkhv
Timeline for d1rgig1: